PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H03057.1.p
Common NameEUGRSUZ_H03057, LOC104414502
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 331aa    MW: 37268.2 Da    PI: 5.0134
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H03057.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.7e-191461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l  +++++G ++W++ +++ g+ R++k+c++rw +yl
  Eucgr.H03057.1.p 14 KGPWTPEEDQKLFSYIQKHGHPNWRALPKHAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding46.68.1e-1567110146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++ eE+e +++++++lG++ W++I ++++ gRt++++k+ w++
  Eucgr.H03057.1.p  67 RGNFSSEEEETIIKLHEMLGNR-WSAIVAKLP-GRTDNEIKNVWHT 110
                       89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.022965IPR017930Myb domain
SuperFamilySSF466893.24E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-151363IPR001005SANT/Myb domain
PfamPF002494.2E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-251568IPR009057Homeodomain-like
CDDcd001675.07E-121661No hitNo description
SMARTSM007171.0E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129418.62866116IPR017930Myb domain
PfamPF002493.6E-1367110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2469117IPR009057Homeodomain-like
CDDcd001671.43E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MVRSSCCWRA GLKKGPWTPE EDQKLFSYIQ KHGHPNWRAL PKHAGLLRCG KSCRLRWTNY  60
LRPDIKRGNF SSEEEETIIK LHEMLGNRWS AIVAKLPGRT DNEIKNVWHT RLKKRVKQKQ  120
ANHHPSTASA SASSSAATPA LSINSSTVND PPEPEDSNCS RPPGFESPRY ARSSSPPRSS  180
SKISCTSDPV MATAEPNYNL DVLIVDQNPT ESIESVPDFW SDPISANSYV SLSSDFAGLT  240
SSDDQAQQVE FPLDKTLNDL QFWPEFKDVP SDFGQANEAQ QHEFPWDMND RFELWSGDSN  300
SMIDDGVDYF WYDLLVRAEG SEELPFPEIN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H03057.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010023946.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A059B3V60.0A0A059B3V6_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-66myb domain protein 14